PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018797
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 375aa    MW: 40914 Da    PI: 6.1272
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018797genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.77.7e-062161438
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
               + C+ ++  ++  +C+ ++ +lC  C  ++H        H+
  Cla018797 21 KPCDSCKTAPAAVYCRPDSAFLCLPCDAKIHCAnklasrHE 61
               57****************************95545566665 PP

2zf-B_box27.94.9e-0963108342
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                 ++C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  Cla018797  63 VWMCEVCEQAPAVVMCKADAAALCVTCDADIHSAnplarrHERVPV 108
                689*****************************66899999999986 PP

3CCT70.25.2e-24302345144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Cla018797 302 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 345
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.4E-111865IPR000315B-box-type zinc finger
CDDcd000213.96E-82265No hitNo description
PROSITE profilePS501199.8972365IPR000315B-box-type zinc finger
PROSITE profilePS5011910.93661108IPR000315B-box-type zinc finger
PfamPF006434.5E-763108IPR000315B-box-type zinc finger
CDDcd000216.83E-964108No hitNo description
SMARTSM003368.5E-1166108IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787302344IPR010402CCT domain
PfamPF062035.8E-18302344IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGIDADSVVK GFGGGWGVVA KPCDSCKTAP AAVYCRPDSA FLCLPCDAKI HCANKLASRH  60
ERVWMCEVCE QAPAVVMCKA DAAALCVTCD ADIHSANPLA RRHERVPVEP FFDTAESVVK  120
SSSVLNFLVP NETNASVCDG AHHHEEVEVA SWLLSNPSFN SKLVDGSEIK PPGGDQLFFN  180
EMDSFIDFEY PNPVNNHSAI NDSVVPIQTK PLSTPVINHT HSPENCYDID FCRSKLNSFG  240
YQPQSLSHSV SSSSLEVGVV PEGNSMSDIS YPLGQNASNG ADSGLPLSGS GNQATQLCGM  300
DREARVLRYR EKRKNRKFEK TIRYASRKAY AETRPRIKGR FAKRTDMLSE VDEIYGSAAS  360
SMFLTDVQYG VVPTF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656660.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X2
SwissprotQ9FHH81e-120COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0A0LUG10.0A0A0A0LUG1_CUCSA; Zinc finger protein
STRINGGLYMA13G01290.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-107CONSTANS-like 5